PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00853.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 360aa    MW: 39281.1 Da    PI: 9.3398
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00853.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.2e-3964125263
                   zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                              ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+sss
  Rsa1.0_00853.1_g00007.1  64 PQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSS 125
                              6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2663115IPR003851Zinc finger, Dof-type
PfamPF027016.0E-3366122IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90168122IPR003851Zinc finger, Dof-type
PROSITE patternPS01361070106IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MMNVKPMEHI MIPNNNTHQS NTTSNARPNT ILTSSGGVSA AGATVSGVSN NNNTPVVVER  60
KARPQEKLNC PRCNSTNTKF CYYNNYSLTQ PRYFCKGCRR YWTEGGSLRN VPVGGSSRKN  120
KRSSSSSSSN ILQTTPSSHG LTTTLPDLNP PIIFSNQIPN KSKGSQDLNL LSFPVMQDQH  180
HHQHVHMSKF LQMHKMEGNG NMTHQQPSSS SSLYGSSSSP VSALELLRTG VNVSSRSGIN  240
AFMPSGPMMD SSHNVMYTSS GFPTMVDYKT SNLSFSTDNQ GLGHNNNNNS SGDAHSDHHQ  300
GRVLFPFGDQ MKELSSSITQ EVDHDDNQQQ KSHGNNNNNP SPNNGYWSGM FSTTGGGSSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528590.0AK352859.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-N20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294447.10.0hypothetical protein CARUB_v10023459mg
SwissprotQ9ZPY00.0DOF25_ARATH; Dof zinc finger protein DOF2.5
TrEMBLR0HPY20.0R0HPY2_9BRAS; Uncharacterized protein
STRINGBra039272.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25282673
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46590.11e-133Dof family protein